Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human HLA class II histocompatibility antigen gamma chain (CD74) , partial (Active)

Product Specifications

CAS Number

9000-83-3

Gene Name

CD74

UniProt

P04233-2

Expression Region

73-232aa

Organism

Homo sapiens

Target Sequence

QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM

Tag

N-terminal 10xHis-tagged

Source

Mammalian cell

Field of Research

Immunology

Assay Type

Active Protein & In Stock Protein

Relevance

Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal/lysosomal system where the antigen processing and binding of antigenic peptides to MHC class II takes place. Serves as cell surface receptor for the cytokine MIF.[Class-II-associated invariant chain peptide]: Binds to the peptide-binding site of MHC class II alpha/beta heterodimers forming an alpha-beta-CLIP complex, thereby preventing the loading of antigenic peptides to the MHC class II complex until its release by HLA-DM in the endosome.[Isoform p41]: Stabilizes the conformation of mature CTSL by binding to its active site and serving as a chaperone to help maintain a pool of mature enzyme in endocytic compartments and extracellular space of antigen-presenting cells (APCs). Has antiviral activity by stymieing the endosomal entry of Ebola virus and coronaviruses, including SARS-CoV-2 . Disrupts cathepsin-mediated Ebola virus glycoprotein processing, which prevents viral fusion and entry. This antiviral activity is specific to p41 isoform .

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human CD74 at 2 μg/mL can bind Anti-CD74 recombinant antibody (CSB-RA004956A1HU), the EC50 is 1.317-1.646 ng/mL.

Length

Partial of Isoform 2

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

21.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Protein Length

Partial of Isoform 2

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

JOSD1 Polyclonal Conjugated Antibody
MBS9443054-01 0.1 mL (Biotin)

JOSD1 Polyclonal Conjugated Antibody

Ask
View Details
JOSD1 Polyclonal Conjugated Antibody
MBS9443054-02 0.1 mL (AF350)

JOSD1 Polyclonal Conjugated Antibody

Ask
View Details
JOSD1 Polyclonal Conjugated Antibody
MBS9443054-03 0.1 mL (AF405)

JOSD1 Polyclonal Conjugated Antibody

Ask
View Details
JOSD1 Polyclonal Conjugated Antibody
MBS9443054-04 0.1 mL (AF488)

JOSD1 Polyclonal Conjugated Antibody

Ask
View Details
JOSD1 Polyclonal Conjugated Antibody
MBS9443054-05 0.1 mL (AF555)

JOSD1 Polyclonal Conjugated Antibody

Ask
View Details
JOSD1 Polyclonal Conjugated Antibody
MBS9443054-06 0.1 mL (AF594)

JOSD1 Polyclonal Conjugated Antibody

Ask
View Details