What is the catalog number for Human KDM3B protein?

The catalog number for Human KDM3B protein is orb8245.

What sizes are available for Human KDM3B protein?

Human KDM3B protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human KDM3B protein come in?

Human KDM3B protein is available in 3 different pack sizes.

Is Human KDM3B protein in stock?

Human KDM3B protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human KDM3B protein

This Human KDM3B protein spans the amino acid sequence from region 1498-1721aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

JmjC domain-containing histone demethylation protein 2B Jumonji domain-containing protein 1B Nuclear protein 5qNCA

UniProt

Q7LBC6

Expression Region

1498-1721aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 1498-1721aaSequence Info: PartialGlycerol content: 0.5

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPTRFEDLMENLPLPEYTKRDGRLNLASRLPSYFVRPDLGPKMYNAYGLITAEDRRVGTTNLHLDVSDAVNVMVYVGIPIGEGAHDEEVLKTIDEGDADEVTKQRIHDGKEKPGALWHIYAAKDAEKIRELLRKVGEEQGQENPPDHDPIHDQSWYLDQTLRKRLYEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNLYSCIKVAEDFVSPEHVKHCFRLTQEFR