Human JMJD1C protein
This Human JMJD1C protein spans the amino acid sequence from region 2274-2498aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Jumonji domain-containing protein 1C Thyroid receptor-interacting protein 8
UniProt
Q15652
Expression Region
2274-2498aa
Tag
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Metabolism Research
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
45.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 2274-2498aaSequence Info: PartialGlycerol content: 0.5
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MPARYEDLLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLCSAYGVVAAKDHDIGTTNLHIEVSDVVNILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKISKEQGLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVLPAGALHQVQNFHSCIQVTEDFVSPEHLVESFHLTQELR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
217046 50 µg
Triggering Receptor Expressed on Myeloid Cells 2b (TREM-2b)
Sign In for Pricing
View Details 
MBS1024186-01 0.02 mg (E-Coli)
Recombinant Azotobacter vinelandii Coenzyme PQQ synthesis protein B (pqqB)
Sign In for Pricing
View Details MBS1024186-02 0.02 mg (Yeast)
Recombinant Azotobacter vinelandii Coenzyme PQQ synthesis protein B (pqqB)
Sign In for Pricing
View Details