Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human JMJD1C protein

This Human JMJD1C protein spans the amino acid sequence from region 2274-2498aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Jumonji domain-containing protein 1C Thyroid receptor-interacting protein 8

UniProt

Q15652

Expression Region

2274-2498aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 2274-2498aaSequence Info: PartialGlycerol content: 0.5

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPARYEDLLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLCSAYGVVAAKDHDIGTTNLHIEVSDVVNILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKISKEQGLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVLPAGALHQVQNFHSCIQVTEDFVSPEHLVESFHLTQELR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NCOR1 Antibody Picoband® APC Conjugated
A01304-2-APC 100 µg/Vial

Anti-NCOR1 Antibody Picoband® APC Conjugated

Sign In for Pricing
View Details
MBP Polyclonal Antibody
E-AB-70266-01 60 µL

MBP Polyclonal Antibody

Sign In for Pricing
View Details
MBP Polyclonal Antibody
E-AB-70266-02 120 µL

MBP Polyclonal Antibody

Sign In for Pricing
View Details
MBP Polyclonal Antibody
E-AB-70266-03 200 µL

MBP Polyclonal Antibody

Sign In for Pricing
View Details
Beta-Amyloid (1-42) Mouse Monoclonal Antibody (PE-Cy5)
orb909387 100 µL

Beta-Amyloid (1-42) Mouse Monoclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
S-Benzyl-L-cysteine 7-amido-4-methylcoumarin
TXB-00201-01 100 mg

S-Benzyl-L-cysteine 7-amido-4-methylcoumarin

Sign In for Pricing
View Details