Apolipoprotein E protein
This Apolipoprotein E protein spans the amino acid sequence from region 20-311aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Anti-AD2 antibody, Anti-Apo-E antibody, Anti-APOE antibody, Anti-APOE_HUMAN antibody, Anti-APOEA antibody, Anti-Apolipoprotein E antibody, Anti-Apolipoprotein E3 antibody, Anti-ApolipoproteinE antibody, Anti-Apoprotein antibody, Anti-LDLCQ5 antibody, Anti-LPG antibody
UniProt
P18287
Expression Region
20-311aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Oryctolagus cuniculus (Rabbit)
Field of Research
Metabolism Research
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
38.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 19-311aaSequence Info: Full LengthGlycerol content: 0.5
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PGC14Q-50 50 Tests
MODIfinder Real-Time PCR GM Corn MIR162 quantification Kit (UID SYN-IR162-4)
Sign In for Pricing
View Details 
GTR15344229 1 Vial
Lentiviral human SCN4B shRNA (UAS) - Lentiviral human SCN4B shRNA (UAS) (100)
Sign In for Pricing
View Details 302242-HRP 200 µL
Actl6a (Actin-like Protein 6A, 53kD BRG1-Associated Factor A, Actin-Related Protein Baf53a, BRG1-Associated Factor 53A, BAF53A, Actl6a, Actl6, Baf53a) (HRP) discontinued
Sign In for Pricing
View Details