Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein E protein

This Apolipoprotein E protein spans the amino acid sequence from region 20-311aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Anti-AD2 antibody, Anti-Apo-E antibody, Anti-APOE antibody, Anti-APOE_HUMAN antibody, Anti-APOEA antibody, Anti-Apolipoprotein E antibody, Anti-Apolipoprotein E3 antibody, Anti-ApolipoproteinE antibody, Anti-Apoprotein antibody, Anti-LDLCQ5 antibody, Anti-LPG antibody

UniProt

P18287

Expression Region

20-311aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 19-311aaSequence Info: Full LengthGlycerol content: 0.5

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAT6 (N-Acetyltransferase 6 (GCN5-Related), FUS-2, FUS2)
249145 50 µL

NAT6 (N-Acetyltransferase 6 (GCN5-Related), FUS-2, FUS2)

Sign In for Pricing
View Details
M12 muscle-homing peptide
CRB1001635-01 0.5 mg

M12 muscle-homing peptide

Sign In for Pricing
View Details
M12 muscle-homing peptide
CRB1001635-02 1 mg

M12 muscle-homing peptide

Sign In for Pricing
View Details
Cynomolgus LIV-1 Protein, His Tag
orb762426-01 1 mg

Cynomolgus LIV-1 Protein, His Tag

Sign In for Pricing
View Details
Cynomolgus LIV-1 Protein, His Tag
orb762426-02 100 µg

Cynomolgus LIV-1 Protein, His Tag

Sign In for Pricing
View Details
GGT1 Antibody
orb520911-01 50 μL

GGT1 Antibody

Sign In for Pricing
View Details