Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Jag1 protein

This Mouse Jag1 protein spans the amino acid sequence from region 33-334aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD_antigen, CD339

UniProt

Q9QXX0

Expression Region

33-334aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 33-334aaSequence Info: PartialGlycerol content: 0.1

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GQFELEILSMQNVNGELQNGNCCGGVRNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTIQPDSIIEKASHSGMINPSRQWQTLKQNTGIAHFEYQIRVTCDDHYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPDCNKAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNRGTCSNTGPDKYQCSCPEGYSGPNCE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGLV3-1 sgRNA CRISPR Lentivector (Human) (Target 2)
K1065203 1.0 µg DNA

IGLV3-1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Active Myostatin (MSTN)
TRV-0005224-01 10 µg

Active Myostatin (MSTN)

Sign In for Pricing
View Details
Active Myostatin (MSTN)
TRV-0005224-02 50 µg

Active Myostatin (MSTN)

Sign In for Pricing
View Details
Active Myostatin (MSTN)
TRV-0005224-03 100 µg

Active Myostatin (MSTN)

Sign In for Pricing
View Details
Active Myostatin (MSTN)
TRV-0005224-04 200 µg

Active Myostatin (MSTN)

Sign In for Pricing
View Details
Active Myostatin (MSTN)
TRV-0005224-05 500 µg

Active Myostatin (MSTN)

Sign In for Pricing
View Details