Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DBP protein

This Human DBP protein spans the amino acid sequence from region 19-474aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C-Fos-induced growth factor , FIGF

UniProt

P02774

Expression Region

19-474aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 6xHis-taggedExpression Region: 19-474aaSequence Info: Partial Glycerol content: 0.2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPN21 AAV Vector (Human) (CMV)
38157101 1 µg

PTPN21 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
LAR/PTPRF Rabbit Polyclonal Antibody
orb334518 100 µg

LAR/PTPRF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAGEB10 (Center) Rabbit pAb
MBS8552597-01 0.1 mL

MAGEB10 (Center) Rabbit pAb

Sign In for Pricing
View Details
MAGEB10 (Center) Rabbit pAb
MBS8552597-02 0.1 mL (AF405L)

MAGEB10 (Center) Rabbit pAb

Sign In for Pricing
View Details
MAGEB10 (Center) Rabbit pAb
MBS8552597-03 0.1 mL (AF405S)

MAGEB10 (Center) Rabbit pAb

Sign In for Pricing
View Details
MAGEB10 (Center) Rabbit pAb
MBS8552597-04 0.1 mL (AF610)

MAGEB10 (Center) Rabbit pAb

Sign In for Pricing
View Details