Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KLK2 protein

This Human KLK2 protein spans the amino acid sequence from region 25-261aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glandular kallikrein-1

UniProt

P20151

Expression Region

25-261aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 6xHis-taggedExpression Region: 25-261aaSequence Info: Full Length of Mature ProteinGlycerol content: 0.5

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Cardiac Troponin T (cTn-T) ELISA kit
CK-bio-20093-01 48 Tests

Rat Cardiac Troponin T (cTn-T) ELISA kit

Sign In for Pricing
View Details
Rat Cardiac Troponin T (cTn-T) ELISA kit
CK-bio-20093-02 96 Tests

Rat Cardiac Troponin T (cTn-T) ELISA kit

Sign In for Pricing
View Details
Rat Cardiac Troponin T (cTn-T) ELISA kit
CK-bio-20093-03 5x 96 Tests

Rat Cardiac Troponin T (cTn-T) ELISA kit

Sign In for Pricing
View Details
Rat Cardiac Troponin T (cTn-T) ELISA kit
CK-bio-20093-04 10x 96 Tests

Rat Cardiac Troponin T (cTn-T) ELISA kit

Sign In for Pricing
View Details
FGD5 Rabbit Polyclonal Antibody (APC-Cy7)
orb2503325 100 µL

FGD5 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Ethoxy Velpatasvir
448553-01 1 mg

Ethoxy Velpatasvir

Sign In for Pricing
View Details