Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KLK2 protein

This Human KLK2 protein spans the amino acid sequence from region 25-261aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glandular kallikrein-1

UniProt

P20151

Expression Region

25-261aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 6xHis-taggedExpression Region: 25-261aaSequence Info: Full Length of Mature ProteinGlycerol content: 0.5

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTDH Antibody
CSB-PA015143GA01HU 100 µL

MTDH Antibody

Sign In for Pricing
View Details
Rat PXDN (Peroxidasin Homolog) ELISA Kit
MBS8807204-01 48 Well

Rat PXDN (Peroxidasin Homolog) ELISA Kit

Sign In for Pricing
View Details
Rat PXDN (Peroxidasin Homolog) ELISA Kit
MBS8807204-02 96 Well

Rat PXDN (Peroxidasin Homolog) ELISA Kit

Sign In for Pricing
View Details
Rat PXDN (Peroxidasin Homolog) ELISA Kit
MBS8807204-03 5x 96 Well

Rat PXDN (Peroxidasin Homolog) ELISA Kit

Sign In for Pricing
View Details
Rat PXDN (Peroxidasin Homolog) ELISA Kit
MBS8807204-04 10x 96 Well

Rat PXDN (Peroxidasin Homolog) ELISA Kit

Sign In for Pricing
View Details
Anti-CD170/SIGLEC5 Polyclonal Antibody
HT187014-01 50 µg

Anti-CD170/SIGLEC5 Polyclonal Antibody

Sign In for Pricing
View Details