Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dog Cationic trypsin protein

This Dog Cationic trypsin protein spans the amino acid sequence from region 24-246aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cationic trypsin, EC 3.4.21.4

UniProt

P06871

Expression Region

24-246aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 6xHis-SUMO-taggedExpression Region: 24-246aaSequence Info: Full Length of Mature ProteinGlycerol content: 0.5

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVGGYTCSRNSVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSRIQVRLGEYNIAVSEGGEQFINAAKIIRHPRYNANTIDNDIMLIKLSSPATLNSRVSAIALPKSCPAAGTQCLISGWGNTQSIGQNYPDVLQCLKAPILSDSVCRNAYPGQISSNMMCLGYMEGGKDSCQGDSGGPVVCNGELQGVVSWGAGCAQKGKPGVSPKVCKYVSWIQQTIAAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wbscr27 (Mettl27) (NM_024479) Mouse Tagged Lenti ORF Clone
MR202917L4 10 µg

Wbscr27 (Mettl27) (NM_024479) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Nicotinic Acid
B2022824 100 g

Nicotinic Acid

Sign In for Pricing
View Details
Anti Mullerian Hormone antibody
10R-11501 0.5 mg

Anti Mullerian Hormone antibody

Sign In for Pricing
View Details
PYK2 (phospho Tyr580) Polyclonal Antibody
orb1097663-01 50 μL

PYK2 (phospho Tyr580) Polyclonal Antibody

Sign In for Pricing
View Details
PYK2 (phospho Tyr580) Polyclonal Antibody
orb1097663-02 100 µL

PYK2 (phospho Tyr580) Polyclonal Antibody

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Ceuloplasmin (CP)
MBS2150464-01 0.1 mL

APC_Cy7-Linked Monoclonal Antibody to Ceuloplasmin (CP)

Sign In for Pricing
View Details