Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial mrcA protein

This Bacterial mrcA protein spans the amino acid sequence from region 206-413aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Peptidoglycan TGase DD-transpeptidase

UniProt

P0A0Z6

Expression Region

206-413aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Neisseria meningitidis serogroup B (strain MC58)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 6xHis-SUMO-taggedExpression Region: 206-413aaSequence Info: PartialGlycerol content: 0.5

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KAPSAYNPIVNPERAKLRQKYILNNMLEEKMITVQQRDQALNEELHYERFVRKIDQSALYVAEMVRQELYEKYGEDAYTQGFKVYTTVRADHQKVATEALRKALRNFDRGSSYRGAENYIDLSKSEDVEETVSQYLSGLYTVDKMVPAVVLDVTKKKNVVIQLPGGRRVTLDRRALGFAARAVNNEKMGEDRIRRGAVIRVKNNGGRW

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plod3 (NM_011962) Mouse Tagged ORF Clone
MG210405 10 µg

Plod3 (NM_011962) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PON2, ID (PON2, Serum paraoxonase/arylesterase 2, Aromatic esterase 2, Serum aryldialkylphosphatase 2) (PE)
MBS6335894-01 0.2 mL

PON2, ID (PON2, Serum paraoxonase/arylesterase 2, Aromatic esterase 2, Serum aryldialkylphosphatase 2) (PE)

Sign In for Pricing
View Details
PON2, ID (PON2, Serum paraoxonase/arylesterase 2, Aromatic esterase 2, Serum aryldialkylphosphatase 2) (PE)
MBS6335894-02 5x 0.2 mL

PON2, ID (PON2, Serum paraoxonase/arylesterase 2, Aromatic esterase 2, Serum aryldialkylphosphatase 2) (PE)

Sign In for Pricing
View Details
Human CZIB activation kit by CRISPRa
GA110430 1 Kit

Human CZIB activation kit by CRISPRa

Sign In for Pricing
View Details
Calponin 1 Rabbit Monoclonal Antibody
E56G1387 100 µL

Calponin 1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
LOC299271 3'UTR Lenti-reporter-Luc Vector
27101086 1.0 µg

LOC299271 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details