Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial ail protein

This Bacterial ail protein spans the amino acid sequence from region 24-178aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AilAttachment invasion locus protein

UniProt

P16454

Expression Region

24-178aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Yersinia enterocolitica

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 6xHis-SUMO-taggedExpression Region: 24-178aaSequence Info: Full Length of Mature ProteinGlycerol content: 0.5

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASESSISIGYAQSHVKENGYTLDNDPKGFNLKYRYELDDNWGVIGSFAYTHQGYDFFYGSNKFGHGDVDYYSVTMGPSFRINEYVSLYGLLGAAHGKVKASVFDESISASKTSMAYGAGVQFNPLPNFVIDASYEYSKLDSIKVGTWMLGAGYRF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOCK7 AAV siRNA Pooled Vector
18500161 1.0 µg

DOCK7 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
GPR15 Peptide
orb1236863 0.05 mg

GPR15 Peptide

Sign In for Pricing
View Details
Anti-DAP1/DAP Antibody Picoband® (Dylight488 Conjugate)
A02756-3-Dylight488 100 µg

Anti-DAP1/DAP Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
TRNAL6 AAV Vector (Human) (CMV)
48191101 1 µg

TRNAL6 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Nceh1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4885505 3x 1.0 µg

Nceh1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Rabbit major histocompatibility complex-III (MHC III / HLA-III) ELISA Kit
MBS2602189-01 48 Well

Rabbit major histocompatibility complex-III (MHC III / HLA-III) ELISA Kit

Sign In for Pricing
View Details