Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial ail protein

This Bacterial ail protein spans the amino acid sequence from region 24-178aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AilAttachment invasion locus protein

UniProt

P16454

Expression Region

24-178aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Yersinia enterocolitica

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 6xHis-SUMO-taggedExpression Region: 24-178aaSequence Info: Full Length of Mature ProteinGlycerol content: 0.5

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASESSISIGYAQSHVKENGYTLDNDPKGFNLKYRYELDDNWGVIGSFAYTHQGYDFFYGSNKFGHGDVDYYSVTMGPSFRINEYVSLYGLLGAAHGKVKASVFDESISASKTSMAYGAGVQFNPLPNFVIDASYEYSKLDSIKVGTWMLGAGYRF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Apolipoprotein C-II Protein, His, Yeast-200ug
QP5665-ye-200ug 200ug

Recombinant Human Apolipoprotein C-II Protein, His, Yeast-200ug

Sign In for Pricing
View Details
Annexin V-EGFP/PI Apoptosis Kit
E-CK-A219-01 20 Assays

Annexin V-EGFP/PI Apoptosis Kit

Sign In for Pricing
View Details
Annexin V-EGFP/PI Apoptosis Kit
E-CK-A219-02 100 Assays

Annexin V-EGFP/PI Apoptosis Kit

Sign In for Pricing
View Details
Anti-human TNFRSF5 / CD40 (Sotigalimab Biosimilar)
BIO0122SM-5mg 5 mg

Anti-human TNFRSF5 / CD40 (Sotigalimab Biosimilar)

Sign In for Pricing
View Details
HDAC3 Rabbit Polyclonal Antibody
E53P03698 100 µL

HDAC3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KRTAP15-1 Protein Vector (Human) (pPM-C-His)
PV090053 500 ng

KRTAP15-1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details