Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Gfer protein

This Rat Gfer protein spans the amino acid sequence from region 1-198aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Augmenter of liver regeneration

UniProt

Q63042

Expression Region

1-198aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 6xHis-SUMO-taggedExpression Region: 1-198aaSequence Info: Full LengthGlycerol content: 0.5

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAPSEPAGFPRGSRFSFLPGGAHSEMTDDLVTDARGRGARHRKDNAPAAAPAPKGLEHGKRPCRACVDFKSWMRTQQKRDIKFREDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSCD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RRM1 Rabbit mAb [KD Validated] Antibody
orb1950606-01 50 µL

RRM1 Rabbit mAb [KD Validated] Antibody

Sign In for Pricing
View Details
RRM1 Rabbit mAb [KD Validated] Antibody
orb1950606-02 100 µL

RRM1 Rabbit mAb [KD Validated] Antibody

Sign In for Pricing
View Details
PRAMEF12, ID (PRAMEF12, PRAME family member 12) (APC) discontinued
040384-APC 200 µL

PRAMEF12, ID (PRAMEF12, PRAME family member 12) (APC) discontinued

Sign In for Pricing
View Details
Actl7b, Control Peptide (Actin-like 7B, MGC151192, MGC151194, Tact1, Actin-like 7-beta, t-Actin 1)
147592 100 µg

Actl7b, Control Peptide (Actin-like 7B, MGC151192, MGC151194, Tact1, Actin-like 7-beta, t-Actin 1)

Sign In for Pricing
View Details
Methyl 2-O-a-L-fucopyranosyl-b-D-galactoside
OM07644-01 250 mg

Methyl 2-O-a-L-fucopyranosyl-b-D-galactoside

Sign In for Pricing
View Details
Methyl 2-O-a-L-fucopyranosyl-b-D-galactoside
OM07644-02 500 mg

Methyl 2-O-a-L-fucopyranosyl-b-D-galactoside

Sign In for Pricing
View Details