Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Gfer protein

This Rat Gfer protein spans the amino acid sequence from region 1-198aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Augmenter of liver regeneration

UniProt

Q63042

Expression Region

1-198aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 6xHis-SUMO-taggedExpression Region: 1-198aaSequence Info: Full LengthGlycerol content: 0.5

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAPSEPAGFPRGSRFSFLPGGAHSEMTDDLVTDARGRGARHRKDNAPAAAPAPKGLEHGKRPCRACVDFKSWMRTQQKRDIKFREDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSCD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NANOS2 Antibody Blocking peptide
orb1450729 500 µg

NANOS2 Antibody Blocking peptide

Sign In for Pricing
View Details
MDH1 Polyclonal Antibody
E-AB-11386-01 20 µL

MDH1 Polyclonal Antibody

Sign In for Pricing
View Details
MDH1 Polyclonal Antibody
E-AB-11386-02 60 µL

MDH1 Polyclonal Antibody

Sign In for Pricing
View Details
MDH1 Polyclonal Antibody
E-AB-11386-03 120 µL

MDH1 Polyclonal Antibody

Sign In for Pricing
View Details
MDH1 Polyclonal Antibody
E-AB-11386-04 200 µL

MDH1 Polyclonal Antibody

Sign In for Pricing
View Details
ALDH18A1 Antibody (Center)
orb1928197-01 50 µL

ALDH18A1 Antibody (Center)

Sign In for Pricing
View Details