Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Gfer protein

This Rat Gfer protein spans the amino acid sequence from region 1-198aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Augmenter of liver regeneration

UniProt

Q63042

Expression Region

1-198aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 6xHis-SUMO-taggedExpression Region: 1-198aaSequence Info: Full LengthGlycerol content: 0.5

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAPSEPAGFPRGSRFSFLPGGAHSEMTDDLVTDARGRGARHRKDNAPAAAPAPKGLEHGKRPCRACVDFKSWMRTQQKRDIKFREDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSCD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GALNS, ID (GALNS, N-acetylgalactosamine-6-sulfatase, Chondroitinsulfatase, Galactose-6-sulfate sulfatase, N-acetylgalactosamine-6-sulfate sulfatase) (FITC) discontinued
035887-FITC 200 µL

GALNS, ID (GALNS, N-acetylgalactosamine-6-sulfatase, Chondroitinsulfatase, Galactose-6-sulfate sulfatase, N-acetylgalactosamine-6-sulfate sulfatase) (FITC) discontinued

Sign In for Pricing
View Details
MRS2-I Antibody
orb841057 2 mg

MRS2-I Antibody

Sign In for Pricing
View Details
Anti-PPP1CA Polyclonal Antibody
HX093014-01 50 µg

Anti-PPP1CA Polyclonal Antibody

Sign In for Pricing
View Details
Anti-PPP1CA Polyclonal Antibody
HX093014-02 100 µg

Anti-PPP1CA Polyclonal Antibody

Sign In for Pricing
View Details
Tinto ZFAND3 (BSB-169), MMab, 15mL Predilute
MBS373206-01 5 Slides

Tinto ZFAND3 (BSB-169), MMab, 15mL Predilute

Sign In for Pricing
View Details
Tinto ZFAND3 (BSB-169), MMab, 15mL Predilute
MBS373206-02 0.1 mL (Concentrate)

Tinto ZFAND3 (BSB-169), MMab, 15mL Predilute

Sign In for Pricing
View Details