Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial dps protein

This Bacterial dps protein spans the amino acid sequence from region 1-144aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bacterioferritin HP-NAP Neutrophil-activating protein A Short name, NAP A

UniProt

P43313

Expression Region

1-144aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Field of Research

Infectious Disease & Virology; Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Tag info: N-terminal 6xHis-SUMO-taggedExpression Region: 1-144aaSequence Info: Full LengthGlycerol content: 0.5

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIYEEFADMFDDLAERIVQLGHHPLVTLSEAIKLTRVKEETKTSFHSKDIFKEILEDYKYLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSAT1 (phosphoserine Aminotransferase 1, EPIP, MGC1460, PSA, PSAT) (MaxLight 750) discontinued
250556-ML750 100 µL

PSAT1 (phosphoserine Aminotransferase 1, EPIP, MGC1460, PSA, PSAT) (MaxLight 750) discontinued

Sign In for Pricing
View Details
SUN5 Recombinant Protein (Rat)
RP231737 100 µg

SUN5 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Shisa6 3'UTR GFP Stable Cell Line
TU168791 1.0 mL

Shisa6 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
CABP4 Human Over-expression Lysate
orb1376316 20 µg

CABP4 Human Over-expression Lysate

Sign In for Pricing
View Details
ERCC1 Rabbit Polyclonal Antibody (Cy5.5)
orb1050907 100 µL

ERCC1 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
BCRP/ABCG2 Rabbit Polyclonal Antibody (Fluoro488)
orb3081449 100 µg

BCRP/ABCG2 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details