What is the catalog number for Human COLEC11 protein?

The catalog number for Human COLEC11 protein is orb383472.

What sizes are available for Human COLEC11 protein?

Human COLEC11 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human COLEC11 protein come in?

Human COLEC11 protein is available in 3 different pack sizes.

Is Human COLEC11 protein in stock?

Human COLEC11 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human COLEC11 protein

This Human COLEC11 protein spans the amino acid sequence from region 26-271aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Collectin kidney protein 1 Short name, CL-K1

UniProt

Q9BWP8

Expression Region

26-271aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Baculovirus and Mammalian Cell N-terminal 10xHis-tagged and C-terminal Myc-tagged Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM