Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial A673_03341 protein

This Bacterial A673_03341 protein spans the amino acid sequence from region 82-220aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

S4JJH7

Expression Region

82-220aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Mammalian cell

Origin

Salmonella enterica subsp. enterica serovar Enteritidis str. 2009K0958

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Baculovirus and Mammalian Cell N-terminal 10xHis-tagged and C-terminal Myc-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVVGYTDSTGSHDLNMRLSQQRADSVASSLITQGVDASRIRTSGMGPANPIASNSTAEGKAQNRRVEITLSPLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ST6GALNAC6 Protein Vector (Mouse) (pPB-N-His)
PV234411 500 ng

ST6GALNAC6 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Human Serpin A1/alpha-1-Antitrypsin Protein (C-6His)
MBS2553210-01 0.01 mg

Recombinant Human Serpin A1/alpha-1-Antitrypsin Protein (C-6His)

Sign In for Pricing
View Details
Recombinant Human Serpin A1/alpha-1-Antitrypsin Protein (C-6His)
MBS2553210-02 0.05 mg

Recombinant Human Serpin A1/alpha-1-Antitrypsin Protein (C-6His)

Sign In for Pricing
View Details
Recombinant Human Serpin A1/alpha-1-Antitrypsin Protein (C-6His)
MBS2553210-03 5x 0.05 mg

Recombinant Human Serpin A1/alpha-1-Antitrypsin Protein (C-6His)

Sign In for Pricing
View Details
MCCD1 Human Over-expression Lysate
orb1342561 100 µg

MCCD1 Human Over-expression Lysate

Sign In for Pricing
View Details
EMC4 Antibody, FITC Conjugated
MBS7134717-01 0.05 mL

EMC4 Antibody, FITC Conjugated

Sign In for Pricing
View Details