Bacterial A673_03341 protein
This Bacterial A673_03341 protein spans the amino acid sequence from region 82-220aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
UniProt
S4JJH7
Expression Region
82-220aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
Mammalian cell
Origin
Salmonella enterica subsp. enterica serovar Enteritidis str. 2009K0958
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
18.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Baculovirus and Mammalian Cell N-terminal 10xHis-tagged and C-terminal Myc-tagged Partial
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
DVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVVGYTDSTGSHDLNMRLSQQRADSVASSLITQGVDASRIRTSGMGPANPIASNSTAEGKAQNRRVEITLSPLQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7245253-01 48 Well
Sheep Armadillo repeat-containing protein 6 (ARMC6) ELISA Kit
Sign In for Pricing
View Details MBS7245253-02 96 Well
Sheep Armadillo repeat-containing protein 6 (ARMC6) ELISA Kit
Sign In for Pricing
View Details MBS7245253-03 5x 96 Well
Sheep Armadillo repeat-containing protein 6 (ARMC6) ELISA Kit
Sign In for Pricing
View Details MBS7245253-04 10x 96 Well
Sheep Armadillo repeat-containing protein 6 (ARMC6) ELISA Kit
Sign In for Pricing
View Details 
MBS1170246-01 0.02 mg (E-Coli)
Recombinant Nautilia profundicola Phosphoribosylaminoimidazole-succinocarboxamide synthase (purC)
Sign In for Pricing
View Details