Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Qpct protein

This Mouse Qpct protein spans the amino acid sequence from region 36-362aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glutaminyl cyclase Short name, QC

UniProt

Q9CYK2

Expression Region

36-362aa

Tag

N-terminal 6xHis-Myc-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKGVPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNKIIQVFVLEYLHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal P2Y6/P2RY6 Antibody
NBP3-17041-25ul 25 µL

Rabbit Polyclonal P2Y6/P2RY6 Antibody

Sign In for Pricing
View Details
Oct4
RA25045 100 µL

Oct4

Sign In for Pricing
View Details
Mouse Polyclonal RRP1 Antibody
H00008568-B01P 0.05 mg

Mouse Polyclonal RRP1 Antibody

Sign In for Pricing
View Details
MSRA Protein Lysate
OCOA18895-20UG 20 µg

MSRA Protein Lysate

Sign In for Pricing
View Details
Rabbit Polyclonal ARL2BP Antibody [Alexa Fluor 350]
NBP3-00281AF350 0.1 mL

Rabbit Polyclonal ARL2BP Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
ACSM6 Human shRNA Plasmid Kit (Locus ID 142827)
TL306324 1 Kit

ACSM6 Human shRNA Plasmid Kit (Locus ID 142827)

Sign In for Pricing
View Details