Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial uspA protein

This Bacterial uspA protein spans the amino acid sequence from region 2-144aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UspA, STY4212, t3925, Universal stress protein A

UniProt

Q8Z268

Expression Region

2-144aa

Tag

N-terminal 6xHis-Myc-tagged

Source

Mammalian cell

Origin

Salmonella typhi

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AYKHILIAVDLSPESKVLVEKAVSMARPYNAKISLIHVDVNYSDLYTGLIDVNLGDMQKRISKETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GALNT17 (FITC)
563273-01 50 µg

GALNT17 (FITC)

Sign In for Pricing
View Details
GALNT17 (FITC)
563273-02 100 µg

GALNT17 (FITC)

Sign In for Pricing
View Details
Epstein Barr Virus, Nuclear Antigen (Epstein-Barr Nuclear Antigen 1, EBV Nuclear Antigen 1, EBNA1, EBNA-1, EBV, BKRF1, Human Herpes virus 4, HHV4) (MaxLight 650)
MBS6255927-01 0.1 mL

Epstein Barr Virus, Nuclear Antigen (Epstein-Barr Nuclear Antigen 1, EBV Nuclear Antigen 1, EBNA1, EBNA-1, EBV, BKRF1, Human Herpes virus 4, HHV4) (MaxLight 650)

Sign In for Pricing
View Details
Epstein Barr Virus, Nuclear Antigen (Epstein-Barr Nuclear Antigen 1, EBV Nuclear Antigen 1, EBNA1, EBNA-1, EBV, BKRF1, Human Herpes virus 4, HHV4) (MaxLight 650)
MBS6255927-02 5x 0.1 mL

Epstein Barr Virus, Nuclear Antigen (Epstein-Barr Nuclear Antigen 1, EBV Nuclear Antigen 1, EBNA1, EBNA-1, EBV, BKRF1, Human Herpes virus 4, HHV4) (MaxLight 650)

Sign In for Pricing
View Details
TOLLIP-set siRNA/shRNA/RNAi Lentivector (Human)
47279091 4x 500 ng

TOLLIP-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Cavy Macrophage-Stimulating Protein Receptor (MST1R) ELISA Kit
MBS9921571 Inquire

Cavy Macrophage-Stimulating Protein Receptor (MST1R) ELISA Kit

Sign In for Pricing
View Details