Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial uspA protein

This Bacterial uspA protein spans the amino acid sequence from region 2-144aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UspA, STY4212, t3925, Universal stress protein A

UniProt

Q8Z268

Expression Region

2-144aa

Tag

N-terminal 6xHis-Myc-tagged

Source

Mammalian cell

Origin

Salmonella typhi

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AYKHILIAVDLSPESKVLVEKAVSMARPYNAKISLIHVDVNYSDLYTGLIDVNLGDMQKRISKETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Gap junction alpha-4 protein, GJA4 ELISA KIT
ELI-08899h 96 Tests

Human Gap junction alpha-4 protein, GJA4 ELISA KIT

Sign In for Pricing
View Details
Mouse Nuclear RNA Export Factor 1 ELISA kit
GTR10452566 96 Well

Mouse Nuclear RNA Export Factor 1 ELISA kit

Sign In for Pricing
View Details
Lentiviral mouse Msc shRNA (UAS) - Lentiviral mouse Msc shRNA (UAS, iRFP) plasmid
GTR15254344 1 Vial

Lentiviral mouse Msc shRNA (UAS) - Lentiviral mouse Msc shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
MARK4 inhibitor 1
MBS5764616 Inquire

MARK4 inhibitor 1

Sign In for Pricing
View Details
Lentiviral mouse Rbis shRNA (UAS) - Lentiviral mouse Rbis shRNA (UAS, RFP) plasmid
GTR15169441 1 Vial

Lentiviral mouse Rbis shRNA (UAS) - Lentiviral mouse Rbis shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
EIF3J Rabbit pAb
E2863770 100 µL

EIF3J Rabbit pAb

Sign In for Pricing
View Details