Bacterial uspA protein

This Bacterial uspA protein spans the amino acid sequence from region 2-144aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UspA, STY4212, t3925, Universal stress protein A

UniProt

Q8Z268

Expression Region

2-144aa

Tag

N-terminal 6xHis-Myc-tagged

Source

Mammalian cell

Origin

Salmonella typhi

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AYKHILIAVDLSPESKVLVEKAVSMARPYNAKISLIHVDVNYSDLYTGLIDVNLGDMQKRISKETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

orb2825113 100 µL

CDKN2C/p18 INK4c Rabbit pAb, AP conjugated

View Details

AFG-ELL-0497 > 1x 10^6 Cells / Vial

Human Retinal Glioma Cells [WERI-RB-l]

View Details

MBS1113897-01 0.02 mg (E-Coli)

Recombinant Caenorhabditis elegans Nuclear hormone receptor family member nhr-52 (nhr-52)

View Details

MBS1113897-02 0.02 mg (Yeast)

Recombinant Caenorhabditis elegans Nuclear hormone receptor family member nhr-52 (nhr-52)

View Details

MBS1113897-03 0.1 mg (E-Coli)

Recombinant Caenorhabditis elegans Nuclear hormone receptor family member nhr-52 (nhr-52)

View Details

MBS1113897-04 0.1 mg (Yeast)

Recombinant Caenorhabditis elegans Nuclear hormone receptor family member nhr-52 (nhr-52)

View Details