Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial nfuA protein

This Bacterial nfuA protein spans the amino acid sequence from region 1-194aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NfuA, VV1_0864, Fe/S biogenesis protein NfuA

UniProt

Q8DDU2

Expression Region

1-194aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Vibrio vulnificus (strain CMCP6)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Baculovirus and Mammalian Cell N-terminal FC-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SEC14L2 qPCR Primer Pair
QH36001S 200 Tests

Human SEC14L2 qPCR Primer Pair

Sign In for Pricing
View Details
Hang Antibody
orb805672 2 mg

Hang Antibody

Sign In for Pricing
View Details
Mpo Rat Pre-designed siRNA Set A
HY-RS23053 1 Set

Mpo Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Multiplex Assay Kit for Methionine Adenosyltransferase I Alpha (MAT1a), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0030998 96 Tests

Multiplex Assay Kit for Methionine Adenosyltransferase I Alpha (MAT1a), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
SARS-CoV-2 N Protein Rabbit Monoclonal Antibody [Clone ID: OTIR3A8]
TA592314S 30 µL

SARS-CoV-2 N Protein Rabbit Monoclonal Antibody [Clone ID: OTIR3A8]

Sign In for Pricing
View Details
KRT73 CRISPRa sgRNA lentivector (set of three targets)(Rat)
26042126 3x 1.0µg DNA

KRT73 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details