Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial nfuA protein

This Bacterial nfuA protein spans the amino acid sequence from region 1-194aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NfuA, VV1_0864, Fe/S biogenesis protein NfuA

UniProt

Q8DDU2

Expression Region

1-194aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Vibrio vulnificus (strain CMCP6)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Baculovirus and Mammalian Cell N-terminal FC-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serine/threonine protein kinase MAK Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-18635R-BF680 100 µL

Serine/threonine protein kinase MAK Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
RAB26 Rabbit pAb
MBS9142338-01 0.02 mL

RAB26 Rabbit pAb

Sign In for Pricing
View Details
RAB26 Rabbit pAb
MBS9142338-02 0.1 mL

RAB26 Rabbit pAb

Sign In for Pricing
View Details
RAB26 Rabbit pAb
MBS9142338-03 5x 0.1 mL

RAB26 Rabbit pAb

Sign In for Pricing
View Details
SP5 Human Over-expression Lysate
orb1362529 20 µg

SP5 Human Over-expression Lysate

Sign In for Pricing
View Details
CCDC110 (h) -PR
sc-89004-PR 10 µM - 20 µL

CCDC110 (h) -PR

Sign In for Pricing
View Details