Pig HSP90AA1 protein
This Pig HSP90AA1 protein spans the amino acid sequence from region 222-367aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
HSP90AA1, HSP90A, HSPCAHeat shock protein HSP 90-alpha
UniProt
O02705
Expression Region
222-367aa
Tag
N-terminal 6xHis-tagged
Source
Baculovirus
Origin
Sus scrofa (Pig)
Field of Research
Neuroscience
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
19.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Partial
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
VEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNNIKLYVR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
131583-ML750 100 µL
POLR2A (DNA-directed RNA Polymerase II Subunit RPB1, RNA Polymerase II Subunit B1, DNA-directed RNA Polymerase II Subunit A, DNA-directed RNA Polymerase III Largest Subunit, RNA-directed RNA Polymerase II Subunit RPB1, POLR2, MGC75453) (MaxLight 750) discontinued
Sign In for Pricing
View Details 
MBS1441624-01 0.02 mg (E-Coli)
Recombinant Pseudoalteromonas atlantica Transcriptional repressor NrdR (nrdR)
Sign In for Pricing
View Details MBS1441624-02 0.1 mg (E-Coli)
Recombinant Pseudoalteromonas atlantica Transcriptional repressor NrdR (nrdR)
Sign In for Pricing
View Details MBS1441624-03 0.02 mg (Yeast)
Recombinant Pseudoalteromonas atlantica Transcriptional repressor NrdR (nrdR)
Sign In for Pricing
View Details MBS1441624-04 0.1 mg (Yeast)
Recombinant Pseudoalteromonas atlantica Transcriptional repressor NrdR (nrdR)
Sign In for Pricing
View Details