Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Amphibians SAX protein

This Amphibians SAX protein spans the amino acid sequence from region 484-844aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SAX

UniProt

P31226

Expression Region

484-844aa

Tag

N-terminal 6xHis-Myc-tagged

Source

Mammalian cell

Origin

Lithobates catesbeiana (American bullfrog) (Rana catesbeiana)

Field of Research

Microbiology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AHLPSKNKVRWCTINKLEKMKCDDWSAVSGGAIACTEASCPKGCVKQILKGEADAVKLEVQYMYEALMCGLLPAVEEYHNKDDFGPCKTPGSPYTDFGTLRAVALVKKSNKDINWNNIKGKKSCHTGVGDIAGWVIPVSLIRRQNDNSDIDSFFGESCAPGSDTKSNLCKLCIGDPKNSAANTKCSLSDKEAYYGNQGAFRCLVEKGDVAFVPHTVVFENTDGKNPAVWAKNLKSEDFELLCLDGSRAPVSNYKSCKLSGIPPPAIVTREESISDVVRIVANQQSLYGRKGFEKDMFQLFSSNKGNNLLFNDNTQCLITFDRQPKDIMEDYFGKPYYTTVYGASRSAMSSELISACTIKHC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phosphomolybdic Acid Aqueous Solution, 1%
G3470 5x 50 mL

Phosphomolybdic Acid Aqueous Solution, 1%

Sign In for Pricing
View Details
C16orf7 sgRNA CRISPR Lentivector (Human) (Target 2)
K0310203 1.0 µg DNA

C16orf7 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Epiandrosterone Sulfate
T2195L-01 10 mg

Epiandrosterone Sulfate

Sign In for Pricing
View Details
Epiandrosterone Sulfate
T2195L-02 1 g

Epiandrosterone Sulfate

Sign In for Pricing
View Details
Epiandrosterone Sulfate
T2195L-03 1 mg

Epiandrosterone Sulfate

Sign In for Pricing
View Details
Epiandrosterone Sulfate
T2195L-04 50 mg

Epiandrosterone Sulfate

Sign In for Pricing
View Details