Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal TES-26 protein

This Animal TES-26 protein spans the amino acid sequence from region 22-262aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Toxocara excretory-secretory antigen 26 Short name, TES-26

UniProt

P54190

Expression Region

22-262aa

Tag

C-terminal 9xHis-tagged

Source

Baculovirus

Origin

Toxocara canis (Canine roundworm)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E Cadherin (CDH1) (NM_004360) Human Over-expression Lysate
LY401389 100 µg

E Cadherin (CDH1) (NM_004360) Human Over-expression Lysate

Sign In for Pricing
View Details
Centrin 1 (CETN1) (NM_004066) Human Recombinant Protein
TP306285M 100 µg

Centrin 1 (CETN1) (NM_004066) Human Recombinant Protein

Sign In for Pricing
View Details
ARSA (NM_001085427) Human Recombinant Protein
TP313161L 1 mg

ARSA (NM_001085427) Human Recombinant Protein

Sign In for Pricing
View Details
Propylene Glycol-d6 1-Glucuronide (Mixture of Diastereomers) Sodium Salt
TRC-P835237-10MG 10 mg

Propylene Glycol-d6 1-Glucuronide (Mixture of Diastereomers) Sodium Salt

Sign In for Pricing
View Details
Mouse Fap activation kit by CRISPRa
GA201355 1 Kit

Mouse Fap activation kit by CRISPRa

Sign In for Pricing
View Details
CCDC85A (NM_001080433) Human Over-expression Lysate
LC421650 20 µg

CCDC85A (NM_001080433) Human Over-expression Lysate

Sign In for Pricing
View Details