A27L protein
This A27L protein spans the amino acid sequence from region 1-110aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
A27L, A30L14 kDa fusion protein
UniProt
P33816
Expression Region
1-110aa
Tag
N-terminal 10xHis-tagged
Source
Mammalian cell
Origin
Smallpox virus
Field of Research
Microbiology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
15.0 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
B2185-01-ML490 100 µL
Bmi-1, IN (RNF51, MGC12685, BUP, Polycomb group RING finger protein 4) (MaxLight 490) discontinued
Sign In for Pricing
View Details orb1651180-01 20 µg
Recombinant Human Receptor-type tyrosine-protein phosphatase C (PTPRC), partial
Sign In for Pricing
View Details orb1651180-02 100 µg
Recombinant Human Receptor-type tyrosine-protein phosphatase C (PTPRC), partial
Sign In for Pricing
View Details orb1651180-03 1 mg
Recombinant Human Receptor-type tyrosine-protein phosphatase C (PTPRC), partial
Sign In for Pricing
View Details