Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Amigo3 protein

This Rat Amigo3 protein spans the amino acid sequence from region 20-383aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AMIGO-3 Alivin-3

UniProt

Q80ZD5

Expression Region

20-383aa

Tag

N-terminal 6xHis-Myc-tagged

Source

Mammalian cell

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TSDLEGVLPPDPHNCPNKCVCAADVLSCAGRGLQDLPAALPATAAELDLSHNALKRLHPGWLAPLSRLRALYLGYNKLDVLGRGVFTNASGLRILDLSSNLLRRLRTYDLDGLEELEKLLLFNNRLMHLDLDAFQGLSMLSHLYLSCNELSSFSFNHLHGLGLTRLRTLDLSSNWLGHVSVPELAALPTFLKNRLYLHNNPLPCDCSLYHLLRRWHQRGLSALHDFEREYTCLAFKVAESRVRFFEHSRVFKNCSVAAAPGLELPEEELHTHVGQSLRLFCNTTVPAARVAWVSPKNELLVAPGSQDGSIAVLADGSLAIGRVQEQHAGLFVCLASGPRLHHNQTLEYNVSVHKPRPEPEAFNT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CST5 Protein Vector (Rat) (pPB-C-His)
PV262114 500 ng

CST5 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Rat Cross Linked N-Telopeptide of Type I Collagen (NTXI) ELISA Kit
MBS9343775-01 48 Well

Rat Cross Linked N-Telopeptide of Type I Collagen (NTXI) ELISA Kit

Sign In for Pricing
View Details
Rat Cross Linked N-Telopeptide of Type I Collagen (NTXI) ELISA Kit
MBS9343775-02 96 Well

Rat Cross Linked N-Telopeptide of Type I Collagen (NTXI) ELISA Kit

Sign In for Pricing
View Details
Rat Cross Linked N-Telopeptide of Type I Collagen (NTXI) ELISA Kit
MBS9343775-03 5x 96 Well

Rat Cross Linked N-Telopeptide of Type I Collagen (NTXI) ELISA Kit

Sign In for Pricing
View Details
Rat Cross Linked N-Telopeptide of Type I Collagen (NTXI) ELISA Kit
MBS9343775-04 10x 96 Well

Rat Cross Linked N-Telopeptide of Type I Collagen (NTXI) ELISA Kit

Sign In for Pricing
View Details
DNMT3A K44me2 Antibody
orb1254762 100 µL

DNMT3A K44me2 Antibody

Sign In for Pricing
View Details