Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral VACWR090 protein

This Viral VACWR090 protein spans the amino acid sequence from region 1-350aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein F4

UniProt

P07614

Expression Region

1-350aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNTRTDVTNDNIDKNPTKRGDKNIPGRNERFNDQNRFNNDIPKPKPRLQPNQPPKQDNKCREENGDFINIRLCAYEKEYCNDGYLSPAYYMLKQVDDEEMSCWSELSSLVRSRKAVGFPLLKAAKRISHGSMLYFEQFKNSKVVRLTPQVKCLNDTVIFQTVVILYSMYKRGIYSNEFCFDLVSIPRTNIVFSVNQLMFNICTDILVVLSICGNRLYRTNLPQSCYLNFIHGHETIARRGYEHSNYFFEWLIKNHISLLTKQTMDILKVKKKYAIGAPVNRLLEPGTLVYVPKEDYYFIGISLTDVSISDNVRVLFSTDGIVLEIEDFNIKHLFMAGEMFVRSQSSTIIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRK2 Antibody
MBS9602685-01 0.05 mL

GRK2 Antibody

Sign In for Pricing
View Details
GRK2 Antibody
MBS9602685-02 0.1 mL

GRK2 Antibody

Sign In for Pricing
View Details
GRK2 Antibody
MBS9602685-03 0.2 mL

GRK2 Antibody

Sign In for Pricing
View Details
GRK2 Antibody
MBS9602685-04 5x 0.2 mL

GRK2 Antibody

Sign In for Pricing
View Details
YicR Antibody
orb831214 2 mg

YicR Antibody

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A Argininosuccinate lyase (argH)
MBS1409915-01 0.02 mg (E-Coli)

Recombinant Salmonella paratyphi A Argininosuccinate lyase (argH)

Sign In for Pricing
View Details