What is the catalog number for Mouse Sdf2l1 protein?

The catalog number for Mouse Sdf2l1 protein is orb383418.

What sizes are available for Mouse Sdf2l1 protein?

Mouse Sdf2l1 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Mouse Sdf2l1 protein come in?

Mouse Sdf2l1 protein is available in 3 different pack sizes.

Is Mouse Sdf2l1 protein in stock?

Mouse Sdf2l1 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Mouse Sdf2l1 protein

This Mouse Sdf2l1 protein spans the amino acid sequence from region 29-211aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sdf2l1, Stromal cell-derived factor 2-like protein 1, SDF2-like protein 1

UniProt

Q9ESP1

Expression Region

29-211aa

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged and C-terminal Myc-tagged Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SKASAGLVTCGSVLKLLNTHHKVRLHSHDIKYGSGSGQQSVTGVEESDDANSYWRIRGGSEGGCPRGLPVRCGQAVRLTHVLTGKNLHTHHFPSPLSNNQEVSAFGEDGEGDDLDLWTVRCSGQHWEREASVRFQHVGTSVFLSVTGEQYGNPIRGQHEVHGMPSANAHNTWKAMEGIFIKPGADLSTGHDEL