Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Sdf2l1 protein

This Mouse Sdf2l1 protein spans the amino acid sequence from region 29-211aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sdf2l1, Stromal cell-derived factor 2-like protein 1, SDF2-like protein 1

UniProt

Q9ESP1

Expression Region

29-211aa

Tag

N-terminal 6xHis-tagged and C-terminal Myc-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged and C-terminal Myc-tagged Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SKASAGLVTCGSVLKLLNTHHKVRLHSHDIKYGSGSGQQSVTGVEESDDANSYWRIRGGSEGGCPRGLPVRCGQAVRLTHVLTGKNLHTHHFPSPLSNNQEVSAFGEDGEGDDLDLWTVRCSGQHWEREASVRFQHVGTSVFLSVTGEQYGNPIRGQHEVHGMPSANAHNTWKAMEGIFIKPGADLSTGHDEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin Linked Monoclonal Antibody to Visfatin (VF)
MBS2130601-01 0.1 mL

Biotin Linked Monoclonal Antibody to Visfatin (VF)

Sign In for Pricing
View Details
Biotin Linked Monoclonal Antibody to Visfatin (VF)
MBS2130601-02 0.2 mL

Biotin Linked Monoclonal Antibody to Visfatin (VF)

Sign In for Pricing
View Details
Biotin Linked Monoclonal Antibody to Visfatin (VF)
MBS2130601-03 0.5 mL

Biotin Linked Monoclonal Antibody to Visfatin (VF)

Sign In for Pricing
View Details
Biotin Linked Monoclonal Antibody to Visfatin (VF)
MBS2130601-04 1 mL

Biotin Linked Monoclonal Antibody to Visfatin (VF)

Sign In for Pricing
View Details
Biotin Linked Monoclonal Antibody to Visfatin (VF)
MBS2130601-05 5 mL

Biotin Linked Monoclonal Antibody to Visfatin (VF)

Sign In for Pricing
View Details
Biotin Linked Monoclonal Antibody to Visfatin (VF)
MBS2130601-06 5x 5 mL

Biotin Linked Monoclonal Antibody to Visfatin (VF)

Sign In for Pricing
View Details