Human COPS2 protein

Anti ALIENprotein, anti Alien Drosophila himolog ofprotein, anti Alien homologprotein, anti COP 9protein, anti COP9protein, anti COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis) protein, anti COP9 constitutive photomorphogenic homolog subunit 2protein, anti COP9 signalosome complex subunit 2protein, anti COPS 2protein, anti Cops2protein, anti JAB1 containing signalosome subunit 2protein, anti JAB1-containing signalosome subunit 2protein, anti SGN 2protein, anti SGN2protein, anti Signalosome subunit 2protein, anti Thyroid Hormone Receptor Interactor15protein, anti Thyroid Hormone Receptor Interactor 15protein, anti Thyroid receptor-interacting protein 15protein, anti TR-interacting protein 15protein, anti TRIP 15protein, anti TRIP-15protein, anti TRIP15protein

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA