Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Complement C3 protein

This Rat Complement C3 protein spans the amino acid sequence from region 671-746aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Neutrophil chemotactic factor-2

UniProt

P01026

Expression Region

671-746aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMPYSCQRRARLITQGESCLKAFMDCCNYITKLREQHRRDHVLGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM54A (MTFR2) (NM_001099286) Human Recombinant Protein
PH31711E1 50 µg

FAM54A (MTFR2) (NM_001099286) Human Recombinant Protein

Sign In for Pricing
View Details
SUFU Antibody
MBS9230955-01 0.05 mL

SUFU Antibody

Sign In for Pricing
View Details
SUFU Antibody
MBS9230955-02 0.2 mL

SUFU Antibody

Sign In for Pricing
View Details
SUFU Antibody
MBS9230955-03 5x 0.2 mL

SUFU Antibody

Sign In for Pricing
View Details
Pla2g4a Rat shRNA Plasmid (Locus ID 24653)
TR712695 1 Kit

Pla2g4a Rat shRNA Plasmid (Locus ID 24653)

Sign In for Pricing
View Details
PRKACB (NM_001300916) Human Tagged ORF Clone
RC237325 10 µg

PRKACB (NM_001300916) Human Tagged ORF Clone

Sign In for Pricing
View Details