Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SELM protein

This Human SELM protein spans the amino acid sequence from region 24-145aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SELENOM, SELM, Selenoprotein M, SelM

UniProt

Q8WWX9

Expression Region

24-145aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATAYRPDWNRLSGLTRARVETCGGSQLNRLKEVKAFVTQDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETSDHADL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Periaxin (Prx) , partial
MBS1473395-01 0.02 mg (E-Coli)

Recombinant Rat Periaxin (Prx) , partial

Sign In for Pricing
View Details
Recombinant Rat Periaxin (Prx) , partial
MBS1473395-02 0.02 mg (Yeast)

Recombinant Rat Periaxin (Prx) , partial

Sign In for Pricing
View Details
Recombinant Rat Periaxin (Prx) , partial
MBS1473395-03 0.1 mg (E-Coli)

Recombinant Rat Periaxin (Prx) , partial

Sign In for Pricing
View Details
Recombinant Rat Periaxin (Prx) , partial
MBS1473395-04 0.1 mg (Yeast)

Recombinant Rat Periaxin (Prx) , partial

Sign In for Pricing
View Details
Recombinant Rat Periaxin (Prx) , partial
MBS1473395-05 0.02 mg (Baculovirus)

Recombinant Rat Periaxin (Prx) , partial

Sign In for Pricing
View Details
Recombinant Rat Periaxin (Prx) , partial
MBS1473395-06 0.02 mg (Mammalian-Cell)

Recombinant Rat Periaxin (Prx) , partial

Sign In for Pricing
View Details