Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli fimA protein

This E. coli fimA protein spans the amino acid sequence from region 24-182aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Type-1A pilin

UniProt

P04128

Expression Region

24-182aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MRPS16 qPCR Primer Pair
QH40221S 200 Tests

Human MRPS16 qPCR Primer Pair

Sign In for Pricing
View Details
Rat Lars1 Pre-designed siRNA Set B
SI207497B 1 Each

Rat Lars1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
GAD2 Protein Vector (Rat) (pPB-N-His)
PV269483 500 ng

GAD2 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Anti-Anopheles gambiae (African malaria mosquito) AgSTAT Antibody Fluoro488 Conjugated
DZ41843-Fluoro488 200 µL/Vial

Anti-Anopheles gambiae (African malaria mosquito) AgSTAT Antibody Fluoro488 Conjugated

Sign In for Pricing
View Details
Vertical Laminar Airflow BLVR-303
BLVR-303 Each

Vertical Laminar Airflow BLVR-303

Sign In for Pricing
View Details
Recombinant Paecilomyces variotii Endo-1,4-beta-xylanase
MBS1162545-01 0.02 mg (E-Coli)

Recombinant Paecilomyces variotii Endo-1,4-beta-xylanase

Sign In for Pricing
View Details