Human ZNF160 protein
This Human ZNF160 protein spans the amino acid sequence from region 1-147aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Zinc finger protein HZF5 Zinc finger protein Kr18 Short name, HKr18
UniProt
Q9HCG1
Expression Region
1-147aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Epigenetics & Chromatin
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
22.1 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
E.coli and Yeast N-terminal 10xHis-tagged and C-terminal Myc-tagged Full Length of Isoform 2
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MALTQVRLTFRDVAIEFSQEEWKCLDPAQRILYRDVMLENYWNLVSLGLCHFDMNIISMLEEGKEPWTVKSCVKIARKPRTPECVKGVVTDLLRRWKHWLLLLGICCPKPHGRVSSRLRLSRSLGHFFHSAFATFMGVCDKRVGSIF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS961279-01 0.02 mg (E-Coli)
Recombinant Mouse Chromobox protein homolog 2 (Cbx2)
Sign In for Pricing
View Details MBS961279-02 0.02 mg (Yeast)
Recombinant Mouse Chromobox protein homolog 2 (Cbx2)
Sign In for Pricing
View Details MBS961279-03 0.1 mg (E-Coli)
Recombinant Mouse Chromobox protein homolog 2 (Cbx2)
Sign In for Pricing
View Details MBS961279-04 0.1 mg (Yeast)
Recombinant Mouse Chromobox protein homolog 2 (Cbx2)
Sign In for Pricing
View Details MBS961279-05 0.02 mg (Baculovirus)
Recombinant Mouse Chromobox protein homolog 2 (Cbx2)
Sign In for Pricing
View Details MBS961279-06 0.02 mg (Mammalian-Cell)
Recombinant Mouse Chromobox protein homolog 2 (Cbx2)
Sign In for Pricing
View Details