Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ZNF160 protein

This Human ZNF160 protein spans the amino acid sequence from region 1-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zinc finger protein HZF5 Zinc finger protein Kr18 Short name, HKr18

UniProt

Q9HCG1

Expression Region

1-147aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 10xHis-tagged and C-terminal Myc-tagged Full Length of Isoform 2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MALTQVRLTFRDVAIEFSQEEWKCLDPAQRILYRDVMLENYWNLVSLGLCHFDMNIISMLEEGKEPWTVKSCVKIARKPRTPECVKGVVTDLLRRWKHWLLLLGICCPKPHGRVSSRLRLSRSLGHFFHSAFATFMGVCDKRVGSIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cooling agent WS-12
68489-09-8 1 Each

Cooling agent WS-12

Sign In for Pricing
View Details
Lentiviral human ZBTB25 shRNA (UAS) - Lentiviral human ZBTB25 shRNA (UAS, GFP) plasmid
GTR15125110 1 Vial

Lentiviral human ZBTB25 shRNA (UAS) - Lentiviral human ZBTB25 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
RALBP1 Rabbit Polyclonal Antibody (Carrier-free)
orb3114180 100 µg

RALBP1 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
IRF3 Rabbit Polyclonal Antibody (Fluoro550)
orb3119751 100 µg

IRF3 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
Lentiviral human ATP6V0D2 shRNA (UAS) - Lentiviral human ATP6V0D2 shRNA (UAS) (25)
GTR15308828 1 Vial

Lentiviral human ATP6V0D2 shRNA (UAS) - Lentiviral human ATP6V0D2 shRNA (UAS) (25)

Sign In for Pricing
View Details
Anti-CD74 (Recombinant Rabbit, Monoclonal, IgG)
A110417 100 µL

Anti-CD74 (Recombinant Rabbit, Monoclonal, IgG)

Sign In for Pricing
View Details