Human PAEP protein
This Human PAEP protein spans the amino acid sequence from region 19-180aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Placental protein 14 Short name, PP14 Pregnancy-associated endometrial alpha-2 globulin Short name, PAEG Short name, PEG Progestagen-associated endometrial protein Progesterone-associated endometrial protein
UniProt
P09466
Expression Region
19-180aa
Tag
N-terminal 10xHis-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Disease Biomarkers
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
22.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
E.coli and Yeast N-terminal 10xHis-tagged and C-terminal Myc-tagged Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
031980-HRP 200 µL
APOBEC3B, CT (APOBEC3B, Probable DNA dC-dU-editing enzyme APOBEC-3B, Phorbolin-1-related protein, Phorbolin-2/3, PHO3) (Azide free) (HRP) discontinued
Sign In for Pricing
View Details 
GTR15237493 1 Vial
Lentiviral mouse Copg1 shRNA (UAS) - Lentiviral mouse Copg1 shRNA (UAS, RFP) plasmid
Sign In for Pricing
View Details 
135541-ML490 100 µL
ZFAND3 (AN1-type Zinc Finger Protein 3, Testis-expressed Sequence 27, TEX27) (MaxLight 490)
Sign In for Pricing
View Details