Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PAEP protein

This Human PAEP protein spans the amino acid sequence from region 19-180aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Placental protein 14 Short name, PP14 Pregnancy-associated endometrial alpha-2 globulin Short name, PAEG Short name, PEG Progestagen-associated endometrial protein Progesterone-associated endometrial protein

UniProt

P09466

Expression Region

19-180aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Disease Biomarkers

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 10xHis-tagged and C-terminal Myc-tagged Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Des (5-chloro-2-animocarboxythienyl) 4- (3-Oxo-4-morpholinyl) Phenylanimomethyl-2-oxo-3-oxazolidinyl] Rivaroxaban
446173-01 2.5 mg

Des (5-chloro-2-animocarboxythienyl) 4- (3-Oxo-4-morpholinyl) Phenylanimomethyl-2-oxo-3-oxazolidinyl] Rivaroxaban

Sign In for Pricing
View Details
Des (5-chloro-2-animocarboxythienyl) 4- (3-Oxo-4-morpholinyl) Phenylanimomethyl-2-oxo-3-oxazolidinyl] Rivaroxaban
446173-02 5 mg

Des (5-chloro-2-animocarboxythienyl) 4- (3-Oxo-4-morpholinyl) Phenylanimomethyl-2-oxo-3-oxazolidinyl] Rivaroxaban

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDR274C (YDR274C)
MBS1106098-01 0.02 mg (E-Coli)

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDR274C (YDR274C)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDR274C (YDR274C)
MBS1106098-02 0.1 mg (E-Coli)

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDR274C (YDR274C)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDR274C (YDR274C)
MBS1106098-03 0.02 mg (Yeast)

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDR274C (YDR274C)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDR274C (YDR274C)
MBS1106098-04 0.1 mg (Yeast)

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YDR274C (YDR274C)

Sign In for Pricing
View Details