Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCDC3 protein

This Human CCDC3 protein spans the amino acid sequence from region 22-270aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fat/vessel-derived secretory protein Short name, Favine

UniProt

Q9BQI4

Expression Region

22-270aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 10xHis-tagged Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CQLPSEWRPLSEGCRAELAETIVYARVLALHPEAPGLYNHLPWQYHAGQGGLFYSAEVEMLCDQAWGSMLEVPAGSRLNLTGLGYFSCHSHTVVQDYSYFFFLRMDENYNLLPHGVNFQDAIFPDTQENRRMFSSLFQFSNCSQGQQLATFSSDWEIQEDSRLMCSSVQKALFEEEDHVKKLQQKVATLEKRNRQLRERVKKVKRSLRQARKKGRHLELANQKLSEKLAAGALPHINARGPVRPPYLRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PER-3 Rabbit Polyclonal Antibody (RBITC)
orb1066093 100 µL

PER-3 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
OXGR1 Rabbit pAb
E45R21993N-100 100 µL

OXGR1 Rabbit pAb

Sign In for Pricing
View Details
Human Dipeptidyl Peptidase 6 (DPP6) ELISA Kit
RD-DPP6-Hu-96Tests 96 Tests

Human Dipeptidyl Peptidase 6 (DPP6) ELISA Kit

Sign In for Pricing
View Details
Il1rl1 (NM_001025602) Mouse Tagged ORF Clone
MR227098 10 µg

Il1rl1 (NM_001025602) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
HSF1 Antibody
orb2682028-01 50 µL

HSF1 Antibody

Sign In for Pricing
View Details
HSF1 Antibody
orb2682028-02 100 µL

HSF1 Antibody

Sign In for Pricing
View Details