Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial ipaD protein

This Bacterial ipaD protein spans the amino acid sequence from region 1-332aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

36KDA membrane antigen

UniProt

P18013

Expression Region

1-332aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Shigella flexneri

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNITTLTNSISTSSFSPNNTNGSSTETVNSDIKTTTSSHPVSSLTMLNDTLHNIRTTNQALKKELSQKTLTKTSLEEIALHSSQISMDVNKSAQLLDILSRNEYPINKDARELLHSAPKEAELDGDQMISHRELWAKIANSINDINEQYLKVYEHAVSSYTQMYQDFSAVLSSLAGWISPGGNDGNSVKLQVNSLKKALEELKEKYKDKPLYPANNTVSQEQANKWLTELGGTIGKVSQKNGGYVVSINMTPIDNMLKSLDNLGGNGEVVLDNAKYQAWNAGFSAEDETMKNNLQTLVQKYSNANSIFDNLVKVLSSTISSCTDTDKLFLHF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP11 Conjugated Antibody
MBS9457223-01 0.1 mL (Biotin)

USP11 Conjugated Antibody

Sign In for Pricing
View Details
USP11 Conjugated Antibody
MBS9457223-02 0.1 mL (AF350)

USP11 Conjugated Antibody

Sign In for Pricing
View Details
USP11 Conjugated Antibody
MBS9457223-03 0.1 mL (AF405)

USP11 Conjugated Antibody

Sign In for Pricing
View Details
USP11 Conjugated Antibody
MBS9457223-04 0.1 mL (AF488)

USP11 Conjugated Antibody

Sign In for Pricing
View Details
USP11 Conjugated Antibody
MBS9457223-05 0.1 mL (AF555)

USP11 Conjugated Antibody

Sign In for Pricing
View Details
USP11 Conjugated Antibody
MBS9457223-06 0.1 mL (AF594)

USP11 Conjugated Antibody

Sign In for Pricing
View Details