Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial clfA protein

This Bacterial clfA protein spans the amino acid sequence from region 229-559aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibrinogen receptor A Fibrinogen-binding protein A

UniProt

Q5HHM8

Expression Region

229-559aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain COL)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RANTES/CCL5, Human (HEK 293-expressed)
Z03238-25 25 µg

RANTES/CCL5, Human (HEK 293-expressed)

Sign In for Pricing
View Details
ICOS-L / ICOS Ligand / B7RP-1 (Immuno-Oncology Target) (ICOSL/3111), CF647 conjugate, 0.1mg/mL
BNC473111-100 1x 100 µL

ICOS-L / ICOS Ligand / B7RP-1 (Immuno-Oncology Target) (ICOSL/3111), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CDC2L1 (CDK11B) (NM_033488) Human Tagged Lenti ORF Clone
RC216519L4 10 µg

CDC2L1 (CDK11B) (NM_033488) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Boc-Bpa-OH
sc-223824 1 g

Boc-Bpa-OH

Sign In for Pricing
View Details
Biotin, RNA Aptamer, unlabeled
AR-211-U 1 Custom

Biotin, RNA Aptamer, unlabeled

Sign In for Pricing
View Details
PRSS36 Antibody
orb1265330 400 μl

PRSS36 Antibody

Sign In for Pricing
View Details