Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial clfA protein

This Bacterial clfA protein spans the amino acid sequence from region 229-559aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibrinogen receptor A Fibrinogen-binding protein A

UniProt

Q5HHM8

Expression Region

229-559aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain COL)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Transmembrane protein 60 (TMEM60) ELISA Kit
KTE60273-01 48 Tests

Human Transmembrane protein 60 (TMEM60) ELISA Kit

Sign In for Pricing
View Details
Human Transmembrane protein 60 (TMEM60) ELISA Kit
KTE60273-02 96 Tests

Human Transmembrane protein 60 (TMEM60) ELISA Kit

Sign In for Pricing
View Details
Human Transmembrane protein 60 (TMEM60) ELISA Kit
KTE60273-03 5x 96 Tests

Human Transmembrane protein 60 (TMEM60) ELISA Kit

Sign In for Pricing
View Details
Human Transmembrane protein 60 (TMEM60) ELISA Kit
KTE60273-04 50x 96 Tests

Human Transmembrane protein 60 (TMEM60) ELISA Kit

Sign In for Pricing
View Details
Rac-Cyclohexylalaninol Hydrochloride
464373-01 100 mg

Rac-Cyclohexylalaninol Hydrochloride

Sign In for Pricing
View Details
Rac-Cyclohexylalaninol Hydrochloride
464373-02 500 mg

Rac-Cyclohexylalaninol Hydrochloride

Sign In for Pricing
View Details