Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial clfA protein

This Bacterial clfA protein spans the amino acid sequence from region 229-559aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibrinogen receptor A Fibrinogen-binding protein A

UniProt

Q5HHM8

Expression Region

229-559aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain COL)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Speckle-type POZ protein-like (SPOPL) ELISA Kit
EK6595 48 Tests

Mouse Speckle-type POZ protein-like (SPOPL) ELISA Kit

Sign In for Pricing
View Details
THT-5-7546-10 Pre-sized Labels for Printers
020812 10000 Roll (10000 Label (s) x 1 Roll)

THT-5-7546-10 Pre-sized Labels for Printers

Sign In for Pricing
View Details
Recombinant Rabbit Monoclonal Antibody to CD1a / HTA1 (Mature Langerhans Cells Marker) (Clone : C1A/1506R)
12-1047-20 20 µg

Recombinant Rabbit Monoclonal Antibody to CD1a / HTA1 (Mature Langerhans Cells Marker) (Clone : C1A/1506R)

Sign In for Pricing
View Details
Human MNX1 qPCR Primer Pair
QH15857S 200 Tests

Human MNX1 qPCR Primer Pair

Sign In for Pricing
View Details
MT-ND5  polyclonal antibody
BS71867 50 ul

MT-ND5 polyclonal antibody

Sign In for Pricing
View Details
MMP12 Rabbit Polyclonal Antibody
orb1741996 100 µL

MMP12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details