Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MFSD8 protein

This Human MFSD8 protein spans the amino acid sequence from region 1-40aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ceroid-lipofuscinosis neuronal protein 7

UniProt

Q8NHS3

Expression Region

1-40aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-GST-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWRSIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (MS4A1, B1, S7, Bp35, MS4A2, LEU-16, MGC3969, membrane-spanning 4-domains, subfamily A, member 1, B-lymphocyte cell-surface antigen B1) (APC) discontinued
C2270-05C-APC 100 µL

CD20 (MS4A1, B1, S7, Bp35, MS4A2, LEU-16, MGC3969, membrane-spanning 4-domains, subfamily A, member 1, B-lymphocyte cell-surface antigen B1) (APC) discontinued

Sign In for Pricing
View Details
Olaparib Impurity 123
RM-O121750-01 10 mg

Olaparib Impurity 123

Sign In for Pricing
View Details
Olaparib Impurity 123
RM-O121750-02 25 mg

Olaparib Impurity 123

Sign In for Pricing
View Details
Olaparib Impurity 123
RM-O121750-03 50 mg

Olaparib Impurity 123

Sign In for Pricing
View Details
Olaparib Impurity 123
RM-O121750-04 100 mg

Olaparib Impurity 123

Sign In for Pricing
View Details
DTYMK Antibody
orb1322809-01 30 µL

DTYMK Antibody

Sign In for Pricing
View Details