Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral UL83 protein

This Viral UL83 protein spans the amino acid sequence from region 351-480. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

65KDA matrix phosphoprotein Phosphoprotein UL83 Tegument protein UL83

UniProt

P06725

Expression Region

351-480

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FDIDLLLQRGPQYSEHPTFTSQYRIQGKLEYRHTWDRHDEGAAQGDDDVWTSGSDSDEELVTTERKTPRVTGGGAMAGASTSAGRKRKSASSATACTSGVMTRGRLKAESTVAPEEDTDEDSDNEIHNPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Compound N105-0119
orb1990238-01 1 mg

Compound N105-0119

Sign In for Pricing
View Details
Compound N105-0119
orb1990238-02 5 mg

Compound N105-0119

Sign In for Pricing
View Details
NXF1 Rabbit Polyclonal Antibody (FITC)
orb2125164 100 µL

NXF1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
PASD1 rabbit pAb Antibody
orb2304360-01 50 µL

PASD1 rabbit pAb Antibody

Sign In for Pricing
View Details
PASD1 rabbit pAb Antibody
orb2304360-02 100 µL

PASD1 rabbit pAb Antibody

Sign In for Pricing
View Details
Lentiviral human ABCD2 shRNA (UAS) - Lentiviral human ABCD2 shRNA (UAS) plasmid
GTR15353662 1 Vial

Lentiviral human ABCD2 shRNA (UAS) - Lentiviral human ABCD2 shRNA (UAS) plasmid

Sign In for Pricing
View Details